FKBP25 (FKBP3) (NM_002013) Human Mass Spec Standard
CAT#: PH302200
FKBP3 MS Standard C13 and N15-labeled recombinant protein (NP_002004)
View other "FKBP25" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FKBP3 MS Standard C13 and N15-labeled recombinant protein (NP_002004) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202200 |
| Predicted MW | 25.2 kDa |
| Protein Sequence |
>RC202200 protein sequence
Red=Cloning site Green=Tags(s) MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETK RFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQ DGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP NAKLTFEVELVDID myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002004 |
| RefSeq Size | 1353 |
| RefSeq ORF | 672 |
| Synonyms | FKBP-3; FKBP-25; FKBP25; PPIase |
| Locus ID | 2287 |
| Cytogenetics | 14q21.2 |
| Summary | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq, Sep 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400736 | FKBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400736 | Transient overexpression lysate of FK506 binding protein 3, 25kDa (FKBP3) |
CNY 3080.00 |
|
| TP302200 | Recombinant protein of human FK506 binding protein 3, 25kDa (FKBP3), 20 µg |
CNY 2900.00 |
|
| TP721192 | Purified recombinant protein of Human FK506 binding protein 3, 25kDa (FKBP3) |
CNY 1800.00 |
