RAB24 (NM_130781) Human Mass Spec Standard
CAT#: PH302197
RAB24 MS Standard C13 and N15-labeled recombinant protein (NP_570137)
View other "RAB24" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | RAB24 MS Standard C13 and N15-labeled recombinant protein (NP_570137) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202197 |
Predicted MW | 23.1 kDa |
Protein Sequence |
>RC202197 protein sequence
Red=Cloning site Green=Tags(s) MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERY EAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQ DYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_570137 |
RefSeq Size | 1546 |
RefSeq ORF | 609 |
Locus ID | 53917 |
Cytogenetics | 5q35.3 |
Summary | RAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking (Olkkonen et al., 1993 [PubMed 8126105]).[supplied by OMIM, Aug 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408940 | RAB24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422221 | RAB24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408940 | Transient overexpression lysate of RAB24, member RAS oncogene family (RAB24), transcript variant 2 |
CNY 3080.00 |
|
LY422221 | Transient overexpression lysate of RAB24, member RAS oncogene family (RAB24), transcript variant 1 |
CNY 3080.00 |
|
PH305647 | RAB24 MS Standard C13 and N15-labeled recombinant protein (NP_001026847) |
CNY 19520.00 |
|
TP302197 | Recombinant protein of human RAB24, member RAS oncogene family (RAB24), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP305647 | Recombinant protein of human RAB24, member RAS oncogene family (RAB24), transcript variant 1, 20 µg |
CNY 2900.00 |