RAB38 (NM_022337) Human Mass Spec Standard
CAT#: PH302196
RAB38 MS Standard C13 and N15-labeled recombinant protein (NP_071732)
View other "RAB38" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB38 MS Standard C13 and N15-labeled recombinant protein (NP_071732) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202196 |
| Predicted MW | 23.7 kDa |
| Protein Sequence |
>RC202196 protein sequence
Red=Cloning site Green=Tags(s) MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQE RFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNG LKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAK S myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071732 |
| RefSeq Size | 1479 |
| RefSeq ORF | 633 |
| Synonyms | NY-MEL-1; rrGTPbp |
| Locus ID | 23682 |
| Cytogenetics | 11q14.2 |
| Summary | May be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1. Involved in peripheral melanosomal distribution of TYRP1 in melanocytes; the function, which probably is implicating vesicle-trafficking, includes cooperation with ANKRD27 and VAMP7 (By similarity). Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis (PubMed:21255211). Plays an important role in the control of melanin production and melanosome biogenesis (PubMed:23084991). In concert with RAB32, regulates the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411709 | RAB38 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411709 | Transient overexpression lysate of RAB38, member RAS oncogene family (RAB38) |
CNY 3080.00 |
|
| TP302196 | Recombinant protein of human RAB38, member RAS oncogene family (RAB38), 20 µg |
CNY 2900.00 |
