GNPDA2 (NM_138335) Human Mass Spec Standard
CAT#: PH302194
GNPDA2 MS Standard C13 and N15-labeled recombinant protein (NP_612208)
View other "GNPDA2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GNPDA2 MS Standard C13 and N15-labeled recombinant protein (NP_612208) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202194 |
Predicted MW | 30.9 kDa |
Protein Sequence |
>RC202194 protein sequence
Red=Cloning site Green=Tags(s) MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFN MDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGP DGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAF ALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612208 |
RefSeq Size | 2313 |
RefSeq ORF | 420 |
Synonyms | GNP2; SB52 |
Locus ID | 132789 |
Cytogenetics | 4p12 |
Summary | The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012] |
Protein Pathways | Amino sugar and nucleotide sugar metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403353 | GNPDA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403353 | Transient overexpression lysate of glucosamine-6-phosphate deaminase 2 (GNPDA2) |
CNY 3080.00 |
|
TP302194 | Recombinant protein of human glucosamine-6-phosphate deaminase 2 (GNPDA2), 20 µg |
CNY 2900.00 |