GNPDA2 (NM_138335) Human Mass Spec Standard
CAT#: PH302194
GNPDA2 MS Standard C13 and N15-labeled recombinant protein (NP_612208)
View other "GNPDA2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GNPDA2 MS Standard C13 and N15-labeled recombinant protein (NP_612208) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202194 |
| Predicted MW | 30.9 kDa |
| Protein Sequence |
>RC202194 protein sequence
Red=Cloning site Green=Tags(s) MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFN MDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGP DGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVSTMALTVGVGTVMDAREVMILITGAHKAF ALYKAIEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_612208 |
| RefSeq Size | 2313 |
| RefSeq ORF | 825 |
| Synonyms | GNP2; SB52 |
| Locus ID | 132789 |
| Cytogenetics | 4p12 |
| Summary | The protein encoded by this gene is an allosteric enzyme that catalyzes the reversible reaction converting D-glucosamine-6-phosphate into D-fructose-6-phosphate and ammonium. Variations of this gene have been reported to be associated with influencing body mass index and susceptibility to obesity. A pseudogene of this gene is located on chromosome 9. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012] |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403353 | GNPDA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403353 | Transient overexpression lysate of glucosamine-6-phosphate deaminase 2 (GNPDA2) |
CNY 3080.00 |
|
| TP302194 | Recombinant protein of human glucosamine-6-phosphate deaminase 2 (GNPDA2), 20 µg |
CNY 2900.00 |
