Membrin (GOSR2) (NM_004287) Human Mass Spec Standard
CAT＃: PH302175
GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278)
View other "Membrin" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202175 |
| Predicted MW | 24.8 kDa |
| Protein Sequence |
>RC202175 protein sequence
Red=Cloning site Green=Tags(s) MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY LT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004278 |
| RefSeq Size | 3319 |
| RefSeq ORF | 636 |
| Synonyms | Bos1; EPM6; GS27 |
| Locus ID | 9570 |
| Cytogenetics | 17q21.32 |
| Summary | This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409306 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418077 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422877 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409306 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant B |
CNY 3080.00 |
|
| LY418077 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant A |
CNY 3080.00 |
|
| LY422877 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant C |
CNY 3080.00 |
|
| TP302175 | Recombinant protein of human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A, 20 µg |
CNY 2900.00 |
其它Membrin产品
