GCIP interacting protein p29 (SYF2) (NM_015484) Human Mass Spec Standard
CAT#: PH302167
SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299)
View other "GCIP interacting protein p29" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SYF2 MS Standard C13 and N15-labeled recombinant protein (NP_056299) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202167 |
| Predicted MW | 28.7 kDa |
| Protein Sequence |
>RC202167 protein sequence
Red=Cloning site Green=Tags(s) MAAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEA KKARLEWELKEEEKKKECAARGEDYEKVKLLEISAEDAERWERKKKRKNPDLGFSDYAAAQLRQYHRLTK QIKPDMETYERLREKHGEEFFPTSNSLLHGTHVPSTEEIDRMVIDLEKQIEKRDKYSRRRPYNDDADIDY INERNAKFNKKAERFYGKYTAEIKQNLERGTAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056299 |
| RefSeq Size | 1777 |
| RefSeq ORF | 729 |
| Synonyms | CBPIN; fSAP29; NTC31; P29 |
| Locus ID | 25949 |
| Cytogenetics | 1p36.11 |
| Summary | This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404061 | SYF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414518 | SYF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404061 | Transient overexpression lysate of SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 2 |
CNY 3080.00 |
|
| LY414518 | Transient overexpression lysate of SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1 |
CNY 3080.00 |
|
| TP302167 | Recombinant protein of human SYF2 homolog, RNA splicing factor (S. cerevisiae) (SYF2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它GCIP interacting protein p29产品
