SERPINB1 (NM_030666) Human Mass Spec Standard
CAT#: PH302138
SERPINB1 MS Standard C13 and N15-labeled recombinant protein (NP_109591)
View other "SERPINB1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SERPINB1 MS Standard C13 and N15-labeled recombinant protein (NP_109591) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202138 |
| Predicted MW | 42.7 kDa |
| Protein Sequence |
>RC202138 protein sequence
Red=Cloning site Green=Tags(s) MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRF QSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQT EGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIE DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEE SYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE NFTADHPFLFFIRHNSSGSILFLGRFSSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_109591 |
| RefSeq Size | 2678 |
| RefSeq ORF | 1137 |
| Synonyms | EI; ELANH2; HEL-S-27; HEL57; LEI; M/NEI; MNEI; PI-2; PI2 |
| Locus ID | 1992 |
| Cytogenetics | 6p25.2 |
| Summary | The protein encoded by this gene is a member of the serpin family of proteinase inhibitors. Members of this family maintain homeostasis by neutralizing overexpressed proteinase activity through their function as suicide substrates. This protein inhibits the neutrophil-derived proteinases neutrophil elastase, cathepsin G, and proteinase-3 and thus protects tissues from damage at inflammatory sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410744 | SERPINB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410744 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1) |
CNY 3080.00 |
|
| TP302138 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1), 20 µg |
CNY 2900.00 |
|
| TP760029 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 1 (SERPINB1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它SERPINB1产品
