CPSF7 (NM_024811) Human Mass Spec Standard
CAT#: PH302127
CPSF7 MS Standard C13 and N15-labeled recombinant protein (NP_079087)
View other "CPSF7" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CPSF7 MS Standard C13 and N15-labeled recombinant protein (NP_079087) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202127 |
Predicted MW | 52.1 kDa |
Protein Sequence |
>RC202127 protein sequence
Red=Cloning site Green=Tags(s) MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAI LYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHK LLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDSADGRATPSENLVP SSARVDKPPSVLPYFNRPPSALPLMGLPPPPIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVP PPGAIPPALHLNPAFFPPPNATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSS AISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079087 |
RefSeq Size | 3764 |
RefSeq ORF | 1413 |
Synonyms | CFIm59 |
Locus ID | 79869 |
Cytogenetics | 11q12.2 |
Summary | Cleavage factor Im (CFIm) is one of six factors necessary for correct cleavage and polyadenylation of pre-mRNAs. CFIm is composed of three different subunits of 25, 59, and 68 kDa, and it functions as a heterotetramer, with a dimer of the 25 kDa subunit binding to two of the 59 or 68 kDa subunits. The protein encoded by this gene represents the 59 kDa subunit, which can interact with the splicing factor U2 snRNP Auxiliary Factor (U2AF) 65 to link the splicing and polyadenylation complexes. [provided by RefSeq, Oct 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411065 | CPSF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427787 | CPSF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411065 | Transient overexpression lysate of cleavage and polyadenylation specific factor 7, 59kDa (CPSF7), transcript variant 1 |
CNY 3080.00 |
|
LY427787 | Transient overexpression lysate of cleavage and polyadenylation specific factor 7, 59kDa (CPSF7), transcript variant 2 |
CNY 3080.00 |
|
TP302127 | Recombinant protein of human pre-mRNA cleavage factor I, 59 kDa subunit (FLJ12529), transcript variant 1, 20 µg |
CNY 2900.00 |