SEC11C (NM_033280) Human Mass Spec Standard
CAT#: PH302122
SEC11C MS Standard C13 and N15-labeled recombinant protein (NP_150596)
View other "SEC11C" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SEC11C MS Standard C13 and N15-labeled recombinant protein (NP_150596) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202122 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC202122 protein sequence
Red=Cloning site Green=Tags(s) MVRAGAVGAHLPASGLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSME PAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKE GQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_150596 |
| RefSeq Size | 793 |
| RefSeq ORF | 576 |
| Synonyms | SEC11L3; SPC21; SPCS4C |
| Locus ID | 90701 |
| Cytogenetics | 18q21.32 |
| Summary | Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Protease, Transmembrane |
| Protein Pathways | Protein export |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403241 | SEC11C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403241 | Transient overexpression lysate of SEC11 homolog C (S. cerevisiae) (SEC11C) |
CNY 3080.00 |
|
| TP302122 | Recombinant protein of human SEC11 homolog C (S. cerevisiae) (SEC11C), 20 µg |
CNY 2900.00 |
