S100A3 (NM_002960) Human Mass Spec Standard
CAT#: PH302117
S100A3 MS Standard C13 and N15-labeled recombinant protein (NP_002951)
View other "S100A3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | S100A3 MS Standard C13 and N15-labeled recombinant protein (NP_002951) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202117 |
Predicted MW | 11.7 kDa |
Protein Sequence |
>RC202117 protein sequence
Red=Cloning site Green=Tags(s) MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEV DFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002951 |
RefSeq Size | 738 |
RefSeq ORF | 303 |
Synonyms | S100E |
Locus ID | 6274 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418990 | S100A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418990 | Transient overexpression lysate of S100 calcium binding protein A3 (S100A3) |
CNY 3080.00 |
|
TP302117 | Recombinant protein of human S100 calcium binding protein A3 (S100A3), 20 µg |
CNY 2900.00 |