CBFB (NM_001755) Human Mass Spec Standard
CAT#: PH302111
CBFB MS Standard C13 and N15-labeled recombinant protein (NP_001746)
View other "CBFB" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CBFB MS Standard C13 and N15-labeled recombinant protein (NP_001746) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202111 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC202111 protein sequence
Red=Cloning site Green=Tags(s) MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQ QAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001746 |
| RefSeq Size | 3181 |
| RefSeq ORF | 546 |
| Synonyms | PEBP2B |
| Locus ID | 865 |
| Cytogenetics | 16q22.1 |
| Summary | The protein encoded by this gene is the beta subunit of a heterodimeric core-binding transcription factor belonging to the PEBP2/CBF transcription factor family which master-regulates a host of genes specific to hematopoiesis (e.g., RUNX1) and osteogenesis (e.g., RUNX2). The beta subunit is a non-DNA binding regulatory subunit; it allosterically enhances DNA binding by alpha subunit as the complex binds to the core site of various enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers and GM-CSF promoters. Alternative splicing generates two mRNA variants, each encoding a distinct carboxyl terminus. In some cases, a pericentric inversion of chromosome 16 [inv(16)(p13q22)] produces a chimeric transcript consisting of the N terminus of core-binding factor beta in a fusion with the C-terminal portion of the smooth muscle myosin heavy chain 11. This chromosomal rearrangement is associated with acute myeloid leukemia of the M4Eo subtype. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400665 | CBFB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411522 | CBFB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400665 | Transient overexpression lysate of core-binding factor, beta subunit (CBFB), transcript variant 2 |
CNY 3080.00 |
|
| LY411522 | Transient overexpression lysate of core-binding factor, beta subunit (CBFB), transcript variant 1 |
CNY 3080.00 |
|
| TP302111 | Recombinant protein of human core-binding factor, beta subunit (CBFB), transcript variant 2, 20 µg |
CNY 2900.00 |
