BPGM (NM_199186) Human Mass Spec Standard
CAT#: PH302105
BPGM MS Standard C13 and N15-labeled recombinant protein (NP_954655)
View other "BPGM" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BPGM MS Standard C13 and N15-labeled recombinant protein (NP_954655) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202105 |
| Predicted MW | 30 kDa |
| Protein Sequence |
>RC202105 protein sequence
Red=Cloning site Green=Tags(s) MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLI LEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDR RYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINI TLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_954655 |
| RefSeq Size | 2121 |
| RefSeq ORF | 777 |
| Synonyms | DPGM; ECYT8 |
| Locus ID | 669 |
| Cytogenetics | 7q33 |
| Summary | 2,3-diphosphoglycerate (2,3-DPG) is a small molecule found at high concentrations in red blood cells where it binds to and decreases the oxygen affinity of hemoglobin. This gene encodes a multifunctional enzyme that catalyzes 2,3-DPG synthesis via its synthetase activity, and 2,3-DPG degradation via its phosphatase activity. The enzyme also has phosphoglycerate phosphomutase activity. Deficiency of this enzyme increases the affinity of cells for oxygen. Mutations in this gene result in hemolytic anemia. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404682 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419780 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430797 | BPGM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404682 | Transient overexpression lysate of 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2 |
CNY 3080.00 |
|
| LY419780 | Transient overexpression lysate of 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1 |
CNY 3080.00 |
|
| PH323838 | BPGM MS Standard C13 and N15-labeled recombinant protein (NP_001715) |
CNY 19520.00 |
|
| TP302105 | Recombinant protein of human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323838 | Recombinant protein of human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720896 | Purified recombinant protein of Human 2,3-bisphosphoglycerate mutase (BPGM), transcript variant 2 |
CNY 1800.00 |
