NIP7 (NM_016101) Human Mass Spec Standard
CAT#: PH302103
NIP7 MS Standard C13 and N15-labeled recombinant protein (NP_057185)
View other "NIP7" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NIP7 MS Standard C13 and N15-labeled recombinant protein (NP_057185) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202103 |
| Predicted MW | 20.5 kDa |
| Protein Sequence |
>RC202103 protein sequence
Red=Cloning site Green=Tags(s) MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCF GKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIP LGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057185 |
| RefSeq Size | 2328 |
| RefSeq ORF | 540 |
| Synonyms | CGI-37; HSPC031; KD93 |
| Locus ID | 51388 |
| Cytogenetics | 16q22.1 |
| Summary | Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414162 | NIP7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414162 | Transient overexpression lysate of nuclear import 7 homolog (S. cerevisiae) (NIP7) |
CNY 3080.00 |
|
| TP302103 | Recombinant protein of human nuclear import 7 homolog (S. cerevisiae) (NIP7), 20 µg |
CNY 2900.00 |
|
| TP720548 | Recombinant protein of human nuclear import 7 homolog (S. cerevisiae) (NIP7) |
CNY 1800.00 |
