IRF2 (NM_002199) Human Mass Spec Standard
CAT#: PH302102
IRF2 MS Standard C13 and N15-labeled recombinant protein (NP_002190)
View other "IRF2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | IRF2 MS Standard C13 and N15-labeled recombinant protein (NP_002190) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202102 |
| Predicted MW | 39.4 kDa |
| Protein Sequence |
>RC202102 protein sequence
Red=Cloning site Green=Tags(s) MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVD KPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP VESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESD EQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASF VTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002190 |
| RefSeq Size | 2302 |
| RefSeq ORF | 1047 |
| Synonyms | IRF-2 |
| Locus ID | 3660 |
| Cytogenetics | 4q35.1 |
| Summary | IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400800 | IRF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400800 | Transient overexpression lysate of interferon regulatory factor 2 (IRF2) |
CNY 3080.00 |
|
| TP302102 | Recombinant protein of human interferon regulatory factor 2 (IRF2), 20 µg |
CNY 2900.00 |
|
| TP710148 | Recombinant protein of human interferon regulatory factor 2 (IRF2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
