TFPI (NM_001032281) Human Mass Spec Standard
CAT#: PH302098
TFPI MS Standard C13 and N15-labeled recombinant protein (NP_001027452)
View other "TFPI" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | TFPI MS Standard C13 and N15-labeled recombinant protein (NP_001027452) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202098 |
Predicted MW | 28.7 kDa |
Protein Sequence |
>RC202098 protein sequence
Red=Cloning site Green=Tags(s) MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRF FFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITR YFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFV TKEGTNDGWKNAAHIYQVFLNAFCIHASMFFLGLDSISCLC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001027452 |
RefSeq Size | 1166 |
RefSeq ORF | 753 |
Synonyms | EPI; LACI; TFI; TFPI1 |
Locus ID | 7035 |
Cytogenetics | 2q32.1 |
Summary | This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization. [provided by RefSeq, Jul 2016] |
Protein Families | Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401895 | TFPI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422293 | TFPI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401895 | Transient overexpression lysate of tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) (TFPI), transcript variant 1 |
CNY 3080.00 |
|
LY422293 | Transient overexpression lysate of tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) (TFPI), transcript variant 2 |
CNY 3080.00 |
|
TP302098 | Recombinant protein of human tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) (TFPI), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP762302 | Purified recombinant protein of Human tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) (TFPI), transcript variant 1, Asp29-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |