CHN 1 (CHN1) (NM_001025201) Human Mass Spec Standard
CAT#: PH302095
CHN1 MS Standard C13 and N15-labeled recombinant protein (NP_001020372)
View other "CHN 1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | CHN1 MS Standard C13 and N15-labeled recombinant protein (NP_001020372) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202095 |
| Predicted MW | 53.2 kDa |
| Protein Sequence |
>RC202095 protein sequence
Red=Cloning site Green=Tags(s) MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAADQLLIVAEGSY LIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTIN PIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIPKYEKIHNFKV HTFRGPHWCEYCANFMWGLIAQGVKCADCGLNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTK RPMVVDMCIREIESRGLNSEGLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDL PIPLITYDAYPKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001020372 |
| RefSeq Size | 2446 |
| RefSeq ORF | 1377 |
| Synonyms | ARHGAP2; CHN; DURS2; NC; RHOGAP2 |
| Locus ID | 1123 |
| Cytogenetics | 2q31.1 |
| Summary | This gene encodes GTPase-activating protein for ras-related p21-rac and a phorbol ester receptor. It is predominantly expressed in neurons, and plays an important role in neuronal signal-transduction mechanisms. Mutations in this gene are associated with Duane's retraction syndrome 2 (DURS2). Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Apr 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400688 | CHN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422480 | CHN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400688 | Transient overexpression lysate of chimerin (chimaerin) 1 (CHN1), transcript variant 1 |
CNY 3080.00 |
|
| LY422480 | Transient overexpression lysate of chimerin (chimaerin) 1 (CHN1), transcript variant 2 |
CNY 3080.00 |
|
| PH322163 | CHN1 MS Standard C13 and N15-labeled recombinant protein (NP_001813) |
CNY 19520.00 |
|
| TP302095 | Recombinant protein of human chimerin (chimaerin) 1 (CHN1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP322163 | Recombinant protein of human chimerin (chimaerin) 1 (CHN1), transcript variant 1, 20 µg |
CNY 2900.00 |
