uPA (PLAU) (NM_002658) Human Mass Spec Standard
CAT#: PH302083
PLAU MS Standard C13 and N15-labeled recombinant protein (NP_002649)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PLAU MS Standard C13 and N15-labeled recombinant protein (NP_002649) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202083 |
| Predicted MW | 48.5 kDa |
| Protein Sequence |
>RC202083 protein sequence
Red=Cloning site Green=Tags(s) MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTC YEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLK PLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCG GSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLK IRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHY YGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR SHTKEENGLAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002649 |
| RefSeq Size | 2395 |
| RefSeq ORF | 1293 |
| Synonyms | ATF; BDPLT5; QPD; u-PA; UPA; URK |
| Locus ID | 5328 |
| Cytogenetics | 10q22.2 |
| Summary | This gene encodes a secreted serine protease that converts plasminogen to plasmin. The encoded preproprotein is proteolytically processed to generate A and B polypeptide chains. These chains associate via a single disulfide bond to form the catalytically inactive high molecular weight urokinase-type plasminogen activator (HMW-uPA). HMW-uPA can be further processed into the catalytically active low molecular weight urokinase-type plasminogen activator (LMW-uPA). This low molecular weight form does not bind to the urokinase-type plasminogen activator receptor. Mutations in this gene may be associated with Quebec platelet disorder and late-onset Alzheimer's disease. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protease |
| Protein Pathways | Complement and coagulation cascades |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400942 | PLAU HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400942 | Transient overexpression lysate of plasminogen activator, urokinase (PLAU), transcript variant 1 |
CNY 3080.00 |
|
| TP302083 | Recombinant protein of human plasminogen activator, urokinase (PLAU), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720654 | Purified recombinant protein of Human plasminogen activator, urokinase (PLAU), transcript variant 1 |
CNY 1800.00 |
