Liver Carboxylesterase 1 (CES1) (NM_001025194) Human Mass Spec Standard
CAT#: PH302081
CES1 MS Standard C13 and N15-labeled recombinant protein (NP_001020365)
View other "Liver Carboxylesterase 1" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CES1 MS Standard C13 and N15-labeled recombinant protein (NP_001020365) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202081 |
Predicted MW | 62.3 kDa |
Protein Sequence |
>RC202081 protein sequence
Red=Cloning site Green=Tags(s) MWLPALVLATLAASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQP AEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLNIYTPADLTKKNRLPVMVWIH GGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIASFGG NPGSVTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSA VMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGI NKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDLI ADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIR LSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLKDKEVAFWTNLFAKKAVEKPPQ TEHIEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001020365 |
RefSeq Size | 2024 |
RefSeq ORF | 1698 |
Synonyms | ACAT; CE-1; CEH; CES2; hCE-1; HMSE; HMSE1; PCE-1; REH; SES1; TGH |
Locus ID | 1066 |
Cytogenetics | 16q12.2 |
Summary | This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400509 | CES1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422599 | CES1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422600 | CES1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY400509 | Transient overexpression lysate of carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 3 |
CNY 3080.00 |
|
LY422599 | Transient overexpression lysate of carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 2 |
CNY 3080.00 |
|
LY422600 | Transient overexpression lysate of carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 1 |
CNY 4840.00 |
|
PH320398 | CES1 MS Standard C13 and N15-labeled recombinant protein (NP_001257) |
CNY 19520.00 |
|
PH320445 | CES1 MS Standard C13 and N15-labeled recombinant protein (NP_001020366) |
CNY 14250.00 |
|
TP302081 | Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP320398 | Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP320445 | Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720377 | Recombinant protein of human carboxylesterase 1 (monocyte/macrophage serine esterase 1) (CES1), transcript variant 2 |
CNY 1800.00 |
其它Liver Carboxylesterase 1产品