PPM1A (NM_021003) Human Mass Spec Standard
CAT#: PH302070
PPM1A MS Standard C13 and N15-labeled recombinant protein (NP_066283)
View other "PPM1A" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PPM1A MS Standard C13 and N15-labeled recombinant protein (NP_066283) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202070 |
Predicted MW | 42.4 kDa |
Protein Sequence |
>RC202070 protein sequence
Red=Cloning site Green=Tags(s) MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKY CCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTY FINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGP TEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGS RDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGE LASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066283 |
RefSeq Size | 8210 |
RefSeq ORF | 1146 |
Synonyms | PP2C-ALPHA; PP2CA; PP2Calpha |
Locus ID | 5494 |
Cytogenetics | 14q23.1 |
Summary | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the activities of, MAP kinases and MAP kinase kinases. It has been shown to inhibit the activation of p38 and JNK kinase cascades induced by environmental stresses. This phosphatase can also dephosphorylate cyclin-dependent kinases, and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to activate the expression of the tumor suppressor gene TP53/p53, which leads to G2/M cell cycle arrest and apoptosis. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402820 | PPM1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406056 | PPM1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402820 | Transient overexpression lysate of protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1 |
CNY 3080.00 |
|
LY406056 | Transient overexpression lysate of protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 2 |
CNY 3080.00 |
|
TP302070 | Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP329231 | Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP720139 | Recombinant protein of human protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform (PPM1A), transcript variant 1 |
CNY 1800.00 |