STOM (NM_004099) Human Mass Spec Standard
CAT#: PH302060
STOM MS Standard C13 and N15-labeled recombinant protein (NP_004090)
View other "STOM" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | STOM MS Standard C13 and N15-labeled recombinant protein (NP_004090) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202060 |
| Predicted MW | 31.8 kDa |
| Protein Sequence |
>RC202060 protein sequence
Red=Cloning site Green=Tags(s) MAEKRHTRDSEAQRLPDSFKDSPSKGLGPCGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGR ILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNAD SATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAE AEASREARAKVIAAEGEMNASRALKEASMVITEYPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGII GAKHSHLG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004090 |
| RefSeq Size | 3198 |
| RefSeq ORF | 864 |
| Synonyms | BND7; EPB7; EPB72 |
| Locus ID | 2040 |
| Cytogenetics | 9q33.2 |
| Summary | This gene encodes a member of a highly conserved family of integral membrane proteins. The encoded protein localizes to the cell membrane of red blood cells and other cell types, where it may regulate ion channels and transporters. Loss of localization of the encoded protein is associated with hereditary stomatocytosis, a form of hemolytic anemia. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418214 | STOM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418214 | Transient overexpression lysate of stomatin (STOM), transcript variant 1 |
CNY 3080.00 |
|
| TP302060 | Recombinant protein of human stomatin (STOM), transcript variant 1, 20 µg |
CNY 2900.00 |
