RAIDD (CRADD) (NM_003805) Human Mass Spec Standard
CAT#: PH302050
CRADD MS Standard C13 and N15-labeled recombinant protein (NP_003796)
View other "RAIDD" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CRADD MS Standard C13 and N15-labeled recombinant protein (NP_003796) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202050 |
| Predicted MW | 22.7 kDa |
| Protein Sequence |
>RC202050 protein sequence
Red=Cloning site Green=Tags(s) MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFD TFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGL SQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003796 |
| RefSeq Size | 1201 |
| RefSeq ORF | 597 |
| Synonyms | MRT34; RAIDD |
| Locus ID | 8738 |
| Cytogenetics | 12q22 |
| Summary | This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apoptosis. A mutation in this gene was associated with cognitive disability. A related pseudogene is found on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401252 | CRADD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401252 | Transient overexpression lysate of CASP2 and RIPK1 domain containing adaptor with death domain (CRADD) |
CNY 3080.00 |
|
| TP302050 | Recombinant protein of human CASP2 and RIPK1 domain containing adaptor with death domain (CRADD), 20 µg |
CNY 2900.00 |
|
| TP720921 | Purified recombinant protein of Human CASP2 and RIPK1 domain containing adaptor with death domain (CRADD) |
CNY 1800.00 |
