DDT (NM_001355) Human Mass Spec Standard
CAT#: PH302047
DDT MS Standard C13 and N15-labeled recombinant protein (NP_001346)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001346) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202047 |
| Predicted MW | 12.7 kDa |
| Protein Sequence |
>RC202047 protein sequence
Red=Cloning site Green=Tags(s) MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001346 |
| RefSeq Size | 688 |
| RefSeq ORF | 354 |
| Synonyms | D-DT; DDCT; MIF-2; MIF2 |
| Locus ID | 1652 |
| Cytogenetics | 22q11.23 |
| Summary | D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419969 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421266 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425972 | DDT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419969 | Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 1 |
CNY 3080.00 |
|
| LY421266 | Transient overexpression lysate of D-dopachrome tautomerase (DDT), transcript variant 2 |
CNY 3080.00 |
|
| PH312637 | DDT MS Standard C13 and N15-labeled recombinant protein (NP_001077861) |
CNY 19520.00 |
|
| TP302047 | Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP312637 | Recombinant protein of human D-dopachrome tautomerase (DDT), transcript variant 2, 20 µg |
CNY 2900.00 |
