Glycogenin 2 (GYG2) (NM_001079855) Human Mass Spec Standard
CAT#: PH302043
GYG2 MS Standard C13 and N15-labeled recombinant protein (NP_001073324)
View other "Glycogenin 2" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GYG2 MS Standard C13 and N15-labeled recombinant protein (NP_001073324) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202043 |
Predicted MW | 52 kDa |
Protein Sequence |
>RC202043 protein sequence
Red=Cloning site Green=Tags(s) MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSAD YIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFV FQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSA KVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTL CRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIAC PETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDL AVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001073324 |
RefSeq Size | 3318 |
RefSeq ORF | 1410 |
Synonyms | GN-2; GN2 |
Locus ID | 8908 |
Cytogenetics | Xp22.33 |
Summary | This gene encodes a member of the the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation reactions of glycogen biosynthesis. A gene on chromosome 3 encodes the muscle glycogenin and this X-linked gene encodes the glycogenin mainly present in liver; both are involved in blood glucose homeostasis. This gene has a short version on chromosome Y, which is 3' truncated and can not make a functional protein. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, May 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421559 | GYG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433068 | GYG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421559 | Transient overexpression lysate of glycogenin 2 (GYG2), transcript variant 1 |
CNY 3080.00 |
|
LY433068 | Transient overexpression lysate of glycogenin 2 (GYG2), transcript variant 4 |
CNY 3080.00 |
|
TP302043 | Recombinant protein of human glycogenin 2 (GYG2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP330068 | Recombinant protein of human glycogenin 2 (GYG2), transcript variant 4, 20 µg |
CNY 2900.00 |
其它Glycogenin 2产品