SCO1 (NM_004589) Human Mass Spec Standard
CAT#: PH302026
SCO1 MS Standard C13 and N15-labeled recombinant protein (NP_004580)
View other "SCO1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SCO1 MS Standard C13 and N15-labeled recombinant protein (NP_004580) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202026 |
Predicted MW | 33.8 kDa |
Protein Sequence |
>RC202026 protein sequence
Red=Cloning site Green=Tags(s) MAMLVLVPGRVMRPLGGQLWRFLPRGLEFWGPAEGTARVLLRQFCARQAEAWRASGRPGYCLGTRPLSTA RPPPPWSQKGPGDSTRPSKPGPVSWKSLAITFAIGGALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPF SLTTHTGERKTDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTK EAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQN KRKGEIAASIATHMRPYRKKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004580 |
RefSeq Size | 1768 |
RefSeq ORF | 903 |
Synonyms | MC4DN4; SCOD1 |
Locus ID | 6341 |
Cytogenetics | 17p13.1 |
Summary | Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated into the holoprotein. This gene is the human homolog to the yeast SCO1 gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417885 | SCO1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417885 | Transient overexpression lysate of SCO cytochrome oxidase deficient homolog 1 (yeast) (SCO1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP302026 | Recombinant protein of human SCO cytochrome oxidase deficient homolog 1 (yeast) (SCO1), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
|
TP720232 | Recombinant protein of human SCO cytochrome oxidase deficient homolog 1 (yeast) (SCO1), nuclear gene encoding mitochondrial protein |
CNY 1800.00 |