LYPLA2 (NM_007260) Human Mass Spec Standard
CAT#: PH302021
LYPLA2 MS Standard C13 and N15-labeled recombinant protein (NP_009191)
View other "LYPLA2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LYPLA2 MS Standard C13 and N15-labeled recombinant protein (NP_009191) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202021 |
| Predicted MW | 24.7 kDa |
| Protein Sequence |
>RC202021 protein sequence
Red=Cloning site Green=Tags(s) MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLA GIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMH SSCPQEMAAVKEFLEKLLPPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009191 |
| RefSeq Size | 1648 |
| RefSeq ORF | 693 |
| Synonyms | APT-2; APT2; DJ886K2.4 |
| Locus ID | 11313 |
| Cytogenetics | 1p36.11 |
| Summary | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Glycerophospholipid metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416098 | LYPLA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416098 | Transient overexpression lysate of lysophospholipase II (LYPLA2) |
CNY 3080.00 |
|
| TP302021 | Recombinant protein of human lysophospholipase II (LYPLA2), 20 µg |
CNY 2900.00 |
|
| TP720900 | Purified recombinant protein of Human lysophospholipase II (LYPLA2) |
CNY 1800.00 |
