EDF1 (NM_003792) Human Mass Spec Standard
CAT#: PH301996
EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_003783)
View other "EDF1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_003783) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201996 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC201996 protein sequence
Red=Cloning site Green=Tags(s) MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP IEKGPRAK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003783 |
RefSeq Size | 701 |
RefSeq ORF | 444 |
Synonyms | CFAP280; EDF-1; MBF1 |
Locus ID | 8721 |
Cytogenetics | 9q34.3 |
Summary | This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407133 | EDF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418427 | EDF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407133 | Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant beta |
CNY 3080.00 |
|
LY418427 | Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant alpha |
CNY 3080.00 |
|
PH312036 | EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_694880) |
CNY 14250.00 |
|
TP301996 | Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, 20 µg |
CNY 2900.00 |
|
TP312036 | Purified recombinant protein of Homo sapiens endothelial differentiation-related factor 1 (EDF1), transcript variant beta, 20 µg |
CNY 2900.00 |
|
TP720515 | Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha |
CNY 1800.00 |