Josephin 1 (JOSD1) (NM_014876) Human Mass Spec Standard
CAT#: PH301968
JOSD1 MS Standard C13 and N15-labeled recombinant protein (NP_055691)
View other "Josephin 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | JOSD1 MS Standard C13 and N15-labeled recombinant protein (NP_055691) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201968 |
Predicted MW | 23.2 kDa |
Protein Sequence |
>RC201968 protein sequence
Red=Cloning site Green=Tags(s) MSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQEIFQRLSPNTMVT PHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHW ICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGKNCELLLVVPEEVEAHQSWRTDV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055691 |
RefSeq Size | 3435 |
RefSeq ORF | 606 |
Synonyms | dJ508I15.2 |
Locus ID | 9929 |
Cytogenetics | 22q13.1 |
Summary | Deubiquitinates monoubiquitinated probes (in vitro). When ubiquitinated, cleaves 'Lys-63'-linked and 'Lys-48'-linked poly-ubiquitin chains (in vitro), hence may act as a deubiquitinating enzyme. May increase macropinocytosis and suppress clathrin- and caveolae-mediated endocytosis. May enhance membrane dynamics and cell motility independently of its catalytic activity.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414963 | JOSD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414963 | Transient overexpression lysate of Josephin domain containing 1 (JOSD1) |
CNY 3080.00 |
|
TP301968 | Recombinant protein of human Josephin domain containing 1 (JOSD1), 20 µg |
CNY 2900.00 |
其它Josephin 1产品