NBL1 (NM_005380) Human Mass Spec Standard
CAT#: PH301954
NBL1 MS Standard C13 and N15-labeled recombinant protein (NP_005371)
View other "NBL1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NBL1 MS Standard C13 and N15-labeled recombinant protein (NP_005371) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201954 |
Predicted MW | 19.3 kDa |
Protein Sequence |
>RC201954 protein sequence
Red=Cloning site Green=Tags(s) MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNT FPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDG PGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005371 |
RefSeq Size | 2184 |
RefSeq ORF | 540 |
Synonyms | D1S1733E; DAN; DAND1; NB; NO3 |
Locus ID | 4681 |
Cytogenetics | 1p36.13 |
Summary | This gene product is the founding member of the evolutionarily conserved CAN (Cerberus and DAN) family of proteins, which contain a domain resembling the CTCK (C-terminal cystine knot-like) motif found in a number of signaling molecules. These proteins are secreted, and act as BMP (bone morphogenetic protein) antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants have been identified for this gene. Read-through transcripts between this locus and the upstream mitochondrial inner membrane organizing system 1 gene (GeneID 440574) have been observed. [provided by RefSeq, May 2013] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417336 | NBL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417336 | Transient overexpression lysate of neuroblastoma, suppression of tumorigenicity 1 (NBL1), transcript variant 2 |
CNY 3080.00 |
|
TP301954 | Recombinant protein of human neuroblastoma, suppression of tumorigenicity 1 (NBL1), transcript variant 2, 20 µg |
CNY 2900.00 |