ZNRD2 (NM_006396) Human Mass Spec Standard
CAT#: PH301946
SSSCA1 MS Standard C13 and N15-labeled recombinant protein (NP_006387)
View other "ZNRD2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SSSCA1 MS Standard C13 and N15-labeled recombinant protein (NP_006387) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201946 |
| Predicted MW | 21.5 kDa |
| Protein Sequence |
>RC201946 protein sequence
Red=Cloning site Green=Tags(s) MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYC VACQELDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPA PAVPPNTDVMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006387 |
| RefSeq Size | 661 |
| RefSeq ORF | 597 |
| Synonyms | p27; SSSCA1 |
| Locus ID | 10534 |
| Cytogenetics | 11q13.1 |
| Summary | This antigen is recognized by a subset of anti-centromere antibodies from patients with scleroderma and/or Sjogren's syndrome. Subcellular localization has not yet been established. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416665 | SSSCA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416665 | Transient overexpression lysate of Sjogren syndrome/scleroderma autoantigen 1 (SSSCA1) |
CNY 3080.00 |
|
| TP301946 | Recombinant protein of human Sjogren syndrome/scleroderma autoantigen 1 (SSSCA1), 20 µg |
CNY 2900.00 |
