ATPase Inhibitory Factor 1 (ATPIF1) (NM_016311) Human Mass Spec Standard
CAT＃: PH301920
ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_057395)
View other "ATPase Inhibitory Factor 1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_057395) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201920 |
| Predicted MW | 12.2 kDa |
| Protein Sequence |
>RC201920 protein sequence
Red=Cloning site Green=Tags(s) MAVTALAARTWLGVWGVRTMQARGFGSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAAL KKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057395 |
| RefSeq Size | 560 |
| RefSeq ORF | 318 |
| Synonyms | ATPI; ATPIF1; ATPIP; IP |
| Locus ID | 93974 |
| Cytogenetics | 1p35.3 |
| Summary | This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406020 | ATPIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC414048 | ATPIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406020 | Transient overexpression lysate of ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
| LY414048 | Transient overexpression lysate of ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| PH313993 | ATPIF1 MS Standard C13 and N15-labeled recombinant protein (NP_835498) |
CNY 19520.00 |
|
| TP301920 | Recombinant protein of human ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313993 | Recombinant protein of human ATPase inhibitory factor 1 (ATPIF1), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2900.00 |
其它ATPase Inhibitory Factor 1产品
