HDAC11 (NM_024827) Human Mass Spec Standard
CAT#: PH301919
HDAC11 MS Standard C13 and N15-labeled recombinant protein (NP_079103)
View other "HDAC11" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | HDAC11 MS Standard C13 and N15-labeled recombinant protein (NP_079103) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201919 |
| Predicted MW | 39.2 kDa |
| Protein Sequence |
>RC201919 protein sequence
Red=Cloning site Green=Tags(s) MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEED LLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGG FHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYP GDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVK RDELVFRMVRGRRVPILMVTSGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079103 |
| RefSeq Size | 2918 |
| RefSeq ORF | 1041 |
| Synonyms | HD11 |
| Locus ID | 79885 |
| Cytogenetics | 3p25.1 |
| Summary | This gene encodes a class IV histone deacetylase. The encoded protein is localized to the nucleus and may be involved in regulating the expression of interleukin 10. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Apr 2009] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403040 | HDAC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427788 | HDAC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403040 | Transient overexpression lysate of histone deacetylase 11 (HDAC11), transcript variant 1 |
CNY 3080.00 |
|
| LY427788 | Transient overexpression lysate of histone deacetylase 11 (HDAC11), transcript variant 2 |
CNY 3080.00 |
|
| TP301919 | Recombinant protein of human histone deacetylase 11 (HDAC11), transcript variant 2, 20 µg |
CNY 2900.00 |
