PGRMC1 (NM_006667) Human Mass Spec Standard
CAT#: PH301918
PGRMC1 MS Standard C13 and N15-labeled recombinant protein (NP_006658)
View other "PGRMC1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 14250.00
Specifications
| Product Data | |
| Description | PGRMC1 MS Standard C13 and N15-labeled recombinant protein (NP_006658) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC201918 | 
| Predicted MW | 21.7 kDa | 
| Protein Sequence | 
                 >RC201918 protein sequence 
Red=Cloning site Green=Tags(s) MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_006658 | 
| RefSeq Size | 1931 | 
| RefSeq ORF | 585 | 
| Synonyms | Dap1; HPR6.6; IZA; MPR | 
| Locus ID | 10857 | 
| Cytogenetics | Xq24 | 
| Summary | This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney. [provided by RefSeq, Mar 2010] | 
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transmembrane | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401994 | PGRMC1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401994 | Transient overexpression lysate of progesterone receptor membrane component 1 (PGRMC1) | 
                                                     CNY 3080.00  | 
                                            |
| TP301918 | Recombinant protein of human progesterone receptor membrane component 1 (PGRMC1), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
