CLIC4 (NM_013943) Human Mass Spec Standard
CAT#: PH301893
CLIC4 MS Standard C13 and N15-labeled recombinant protein (NP_039234)
View other "CLIC4" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CLIC4 MS Standard C13 and N15-labeled recombinant protein (NP_039234) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201893 |
| Predicted MW | 28.8 kDa |
| Protein Sequence |
>RC201893 protein sequence
Red=Cloning site Green=Tags(s) MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_039234 |
| RefSeq Size | 4452 |
| RefSeq ORF | 759 |
| Synonyms | CLIC4L; H1; huH1; MTCLIC; p64H1 |
| Locus ID | 25932 |
| Cytogenetics | 1p36.11 |
| Summary | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Ion Channels: Other |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402262 | CLIC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402262 | Transient overexpression lysate of chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP301893 | Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
|
| TP720517 | Recombinant protein of human chloride intracellular channel 4 (CLIC4), nuclear gene encoding mitochondrial protein |
CNY 1800.00 |
