UBAP1 (NM_016525) Human Mass Spec Standard
CAT＃: PH301858
UBAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057609)
View other "UBAP1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | UBAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057609) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201858 |
| Predicted MW | 55.1 kDa |
| Protein Sequence |
>RC201858 protein sequence
Red=Cloning site Green=Tags(s) MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIK KIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSAT KQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQ DEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKT AKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCT EESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENI EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDN ALEDLMARAGAS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057609 |
| RefSeq Size | 2743 |
| RefSeq ORF | 1506 |
| Synonyms | NAG20; SPG80; UAP; UBAP; UBAP-1 |
| Locus ID | 51271 |
| Cytogenetics | 9p13.3 |
| Summary | This gene is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studies as a putative target for mutation in nasopharyngeal carcinomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402559 | UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433186 | UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433285 | UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402559 | Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 1 |
CNY 3080.00 |
|
| LY433186 | Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 2 |
CNY 3080.00 |
|
| LY433285 | Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 4 |
CNY 3080.00 |
|
| TP301858 | Recombinant protein of human ubiquitin associated protein 1 (UBAP1), 20 µg |
CNY 2900.00 |
