Asparagine synthetase (ASNS) (NM_183356) Human Mass Spec Standard
CAT#: PH301838
ASNS MS Standard C13 and N15-labeled recombinant protein (NP_899199)
View other "Asparagine synthetase" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_899199) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201838 |
| Predicted MW | 64.4 kDa |
| Protein Sequence |
>RC201838 protein sequence
Red=Cloning site Green=Tags(s) MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDE PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK A myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_899199 |
| RefSeq Size | 2362 |
| RefSeq ORF | 1683 |
| Synonyms | ASNSD; TS11 |
| Locus ID | 440 |
| Cytogenetics | 7q21.3 |
| Summary | The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403336 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405247 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419813 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403336 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 1 |
CNY 3080.00 |
|
| LY405247 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 3 |
CNY 3080.00 |
|
| LY419813 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 2 |
CNY 3080.00 |
|
| PH301297 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_001664) |
CNY 19520.00 |
|
| PH315380 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_597680) |
CNY 19520.00 |
|
| TP301297 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP301838 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP315380 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Asparagine synthetase产品
