U1A (SNRPA) (NM_004596) Human Mass Spec Standard
CAT#: PH301818
SNRPA MS Standard C13 and N15-labeled recombinant protein (NP_004587)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SNRPA MS Standard C13 and N15-labeled recombinant protein (NP_004587) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201818 |
| Predicted MW | 31.3 kDa |
| Protein Sequence |
>RC201818 protein sequence
Red=Cloning site Green=Tags(s) MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALR SMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGP VPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHIL FLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFA KK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004587 |
| RefSeq Size | 1646 |
| RefSeq ORF | 846 |
| Synonyms | Mud1; U1-A; U1A |
| Locus ID | 6626 |
| Cytogenetics | 19q13.2 |
| Summary | The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation. [provided by RefSeq, Oct 2010] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417878 | SNRPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417878 | Transient overexpression lysate of small nuclear ribonucleoprotein polypeptide A (SNRPA) |
CNY 3080.00 |
|
| TP301818 | Recombinant protein of human small nuclear ribonucleoprotein polypeptide A (SNRPA), 20 µg |
CNY 2900.00 |
