TPD52L1 (NM_001003396) Human Mass Spec Standard
CAT#: PH301816
TPD52L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003396)
View other "TPD52L1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TPD52L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003396) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201816 |
| Predicted MW | 16.2 kDa |
| Protein Sequence |
>RC201816 protein sequence
Red=Cloning site Green=Tags(s) MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQK LGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPA MRRK SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001003396 |
| RefSeq Size | 1327 |
| RefSeq ORF | 432 |
| Synonyms | D53; TPD53 |
| Locus ID | 7164 |
| Cytogenetics | 6q22.31 |
| Summary | This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed. [provided by RefSeq, Jan 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424123 | TPD52L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424123 | Transient overexpression lysate of tumor protein D52-like 1 (TPD52L1), transcript variant 3 |
CNY 3080.00 |
|
| TP301816 | Recombinant protein of human tumor protein D52-like 1 (TPD52L1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它TPD52L1产品
