HEAB (CLP1) (NM_006831) Human Mass Spec Standard
CAT#: PH301772
CLP1 MS Standard C13 and N15-labeled recombinant protein (NP_006822)
View other "HEAB" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 3340.00
Specifications
Product Data | |
Description | CLP1 MS Standard C13 and N15-labeled recombinant protein (NP_006822) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201772 |
Predicted MW | 47.6 kDa |
Protein Sequence |
>RC201772 protein sequence
Red=Cloning site Green=Tags(s) MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHG CSVQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVVGPTDVGKSTVCRLLLNYAVR LGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSIQAPLVYHFGSTTPGTNIKLYNKITSRLADV FNQRCEVNRRASVSGCVINTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLP KSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQL KLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIR FMDLK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006822 |
RefSeq Size | 1864 |
RefSeq ORF | 1275 |
Synonyms | hClp1; HEAB |
Locus ID | 10978 |
Cytogenetics | 11q12.1 |
Summary | This gene encodes a member of the Clp1 family. The encoded protein is a multifunctional kinase which is a component of the tRNA splicing endonuclease complex and a component of the pre-mRNA cleavage complex II. This protein is implicated in tRNA, mRNA, and siRNA maturation. Mutations in this gene are associated with pontocerebellar hypoplasia type 10 (PCH10). Alternatively splice transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402047 | CLP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428198 | CLP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402047 | Transient overexpression lysate of CLP1, cleavage and polyadenylation factor I subunit, homolog (S. cerevisiae) (CLP1), transcript variant 1 |
CNY 3080.00 |
|
LY428198 | Transient overexpression lysate of CLP1, cleavage and polyadenylation factor I subunit, homolog (S. cerevisiae) (CLP1), transcript variant 2 |
CNY 3080.00 |
|
TP301772 | Recombinant protein of human CLP1, cleavage and polyadenylation factor I subunit, homolog (S. cerevisiae) (CLP1), transcript variant 1, 20 µg |
CNY 2900.00 |