DDX39 (DDX39A) (NM_005804) Human Mass Spec Standard
CAT#: PH301759
DDX39 MS Standard C13 and N15-labeled recombinant protein (NP_005795)
View other "DDX39" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DDX39 MS Standard C13 and N15-labeled recombinant protein (NP_005795) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201759 |
| Predicted MW | 49.1 kDa |
| Protein Sequence |
>RC201759 protein sequence
Red=Cloning site Green=Tags(s) MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEV QHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMP SVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDV QEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDL LDVLEFNQVIIFVKSVQRCMALAQLLVEQNFPAIAIHRGMAQEERLSRYQQFKDFQRRILVATNLFGRGM DIERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNVAELPEEIDIS TYIEQSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005795 |
| RefSeq Size | 1558 |
| RefSeq ORF | 1281 |
| Synonyms | BAT1; BAT1L; DDX39; DDXL; URH49 |
| Locus ID | 10212 |
| Cytogenetics | 19p13.12 |
| Summary | This gene encodes a member of the DEAD box protein family. These proteins are characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene is thought to play a role in the prognosis of patients with gastrointestinal stromal tumors. A pseudogene of this gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417057 | DDX39A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417057 | Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 (DDX39) |
CNY 3080.00 |
|
| TP301759 | Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 (DDX39), 20 µg |
CNY 2900.00 |


