MPP1 (NM_002436) Human Mass Spec Standard
CAT#: PH301754
MPP1 MS Standard C13 and N15-labeled recombinant protein (NP_002427)
View other "MPP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MPP1 MS Standard C13 and N15-labeled recombinant protein (NP_002427) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201754 |
Predicted MW | 52.3 kDa |
Protein Sequence |
>RC201754 protein sequence
Red=Cloning site Green=Tags(s) MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVR LIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKET KGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGS SKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKYLAKHSSIFDQLDVVSYEEVVRLPAF KRKTLVLIGASGVGRSHIKNALLSQNPEKFVYPVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLE FGSYQGNMFGTKFETVHQIHKQNKIAILDIEPQTLKIVRTAELSPFIVFIAPTDQGTQTEALQQLQKDSE AIRSQYAHYFDLSLVNNGVDETLKKLQEAFDQACSSPQWVPVSWVY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002427 |
RefSeq Size | 2067 |
RefSeq ORF | 1398 |
Synonyms | AAG12; DXS552E; EMP55; MRG1; PEMP |
Locus ID | 4354 |
Cytogenetics | Xq28 |
Summary | This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419325 | MPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433095 | MPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433103 | MPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419325 | Transient overexpression lysate of membrane protein, palmitoylated 1, 55kDa (MPP1), transcript variant 1 |
CNY 3080.00 |
|
LY433095 | Transient overexpression lysate of membrane protein, palmitoylated 1, 55kDa (MPP1), transcript variant 3 |
CNY 3080.00 |
|
LY433103 | Transient overexpression lysate of membrane protein, palmitoylated 1, 55kDa (MPP1), transcript variant 2 |
CNY 3080.00 |
|
TP301754 | Recombinant protein of human membrane protein, palmitoylated 1, 55kDa (MPP1), 20 µg |
CNY 2900.00 |