IKK gamma (IKBKG) (NM_003639) Human Mass Spec Standard
CAT#: PH301743
IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_003630)
View other "IKK gamma" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_003630) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201743 |
| Predicted MW | 48.2 kDa |
| Protein Sequence |
>RC201743 protein sequence
Red=Cloning site Green=Tags(s) MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQ ILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKA SVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVE AALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEV IDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQES ARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003630 |
| RefSeq Size | 2123 |
| RefSeq ORF | 1257 |
| Synonyms | AMCBX1; EDAID1; FIP-3; FIP3; Fip3p; IKK-gamma; IKKAP1; IKKG; IMD33; IP; IP1; IP2; IPD2; NEMO; ZC2HC9 |
| Locus ID | 8517 |
| Cytogenetics | Xq28 |
| Summary | This gene encodes the regulatory subunit of the inhibitor of kappaB kinase (IKK) complex, which activates NF-kappaB resulting in activation of genes involved in inflammation, immunity, cell survival, and other pathways. Mutations in this gene result in incontinentia pigmenti, hypohidrotic ectodermal dysplasia, and several other types of immunodeficiencies. A pseudogene highly similar to this locus is located in an adjacent region of the X chromosome. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, MAPK signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Primary immunodeficiency, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400446 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC401206 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420210 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428764 | IKBKG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400446 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2 |
CNY 4840.00 |
|
| LY401206 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3 |
CNY 3080.00 |
|
| LY420210 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1 |
CNY 4840.00 |
|
| LY428764 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4 |
CNY 3080.00 |
|
| PH312996 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001093326) |
CNY 19520.00 |
|
| PH318044 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001093327) |
CNY 19520.00 |
|
| PH326825 | IKBKG MS Standard C13 and N15-labeled recombinant protein (NP_001138727) |
CNY 14250.00 |
|
| TP301743 | Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP312996 | Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP318044 | Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326825 | Purified recombinant protein of Homo sapiens inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma (IKBKG), transcript variant 4, 20 µg |
CNY 2900.00 |
其它IKK gamma产品
