SNRPD2 (NM_004597) Human Mass Spec Standard
CAT#: PH301736
SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588)
View other "SNRPD2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201736 |
| Predicted MW | 13.5 kDa |
| Protein Sequence |
>RC201736 protein sequence
Red=Cloning site Green=Tags(s) MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004588 |
| RefSeq Size | 767 |
| RefSeq ORF | 354 |
| Synonyms | Sm-D2; SMD2; SNRPD1 |
| Locus ID | 6633 |
| Cytogenetics | 19q13.32 |
| Summary | The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406078 | SNRPD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417879 | SNRPD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406078 | Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 2 |
CNY 3080.00 |
|
| LY417879 | Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1 |
CNY 3080.00 |
|
| TP301736 | Recombinant protein of human small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1, 20 µg |
CNY 2900.00 |
