RGS19 (NM_001039467) Human Mass Spec Standard
CAT＃: PH301715
RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_001034556)
View other "RGS19" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_001034556) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201715 |
| Predicted MW | 24.6 kDa |
| Protein Sequence |
>RC201715 protein sequence
Red=Cloning site Green=Tags(s) MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPL PSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR LIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGP SQSSSEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001034556 |
| RefSeq Size | 1493 |
| RefSeq ORF | 651 |
| Synonyms | GAIP; RGSGAIP |
| Locus ID | 10287 |
| Cytogenetics | 20q13.33 |
| Summary | G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417015 | RGS19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422051 | RGS19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417015 | Transient overexpression lysate of regulator of G-protein signaling 19 (RGS19), transcript variant 1 |
CNY 3080.00 |
|
| LY422051 | Transient overexpression lysate of regulator of G-protein signaling 19 (RGS19), transcript variant 2 |
CNY 3080.00 |
|
| PH309082 | RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_005864) |
CNY 19520.00 |
|
| TP301715 | Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP309082 | Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 1, 20 µg |
CNY 2900.00 |
