SUGT1 (NM_006704) Human Mass Spec Standard
CAT#: PH301676
SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_006695)
View other "SUGT1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_006695) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201676 |
Predicted MW | 37.8 kDa |
Protein Sequence |
>RC201676 protein sequence
Red=Cloning site Green=Tags(s) MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKI KYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKI EIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRL FQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006695 |
RefSeq Size | 1705 |
RefSeq ORF | 999 |
Synonyms | SGT1 |
Locus ID | 10910 |
Cytogenetics | 13q14.3 |
Summary | This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes. [provided by RefSeq, Mar 2016] |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416475 | SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427302 | SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416475 | Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2 |
CNY 3080.00 |
|
LY427302 | Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1 |
CNY 3080.00 |
|
PH325548 | SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_001124384) |
CNY 14250.00 |
|
TP301676 | Recombinant protein of human SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP325548 | Purified recombinant protein of Homo sapiens SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1, 20 µg |
CNY 2900.00 |