CREG1 (NM_003851) Human Mass Spec Standard
CAT#: PH301654
CREG1 MS Standard C13 and N15-labeled recombinant protein (NP_003842)
View other "CREG1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CREG1 MS Standard C13 and N15-labeled recombinant protein (NP_003842) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201654 |
| Predicted MW | 24.1 kDa |
| Protein Sequence |
>RC201654 protein sequence
Red=Cloning site Green=Tags(s) MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLPPREDAARVARFVTHVSDWGA LATISTLEAVRGRPFADVLSLSDGPPGAGSGVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGF DPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVT PEEYYNVTVQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003842 |
| RefSeq Size | 2048 |
| RefSeq ORF | 660 |
| Synonyms | CREG |
| Locus ID | 8804 |
| Cytogenetics | 1q24.2 |
| Summary | The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein, Transcription Factors, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418392 | CREG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418392 | Transient overexpression lysate of cellular repressor of E1A-stimulated genes 1 (CREG1) |
CNY 3080.00 |
|
| TP301654 | Recombinant protein of human cellular repressor of E1A-stimulated genes 1 (CREG1), 20 µg |
CNY 2900.00 |
|
| TP750059 | Purified recombinant protein of Human cellular repressor of E1A-stimulated genes 1 (CREG1), full length, with N-terminal HIS tag, expressed in E. coli, 100ug |
CNY 4020.00 |
