SCAMP3 (NM_005698) Human Mass Spec Standard
CAT#: PH301633
SCAMP3 MS Standard C13 and N15-labeled recombinant protein (NP_005689)
View other "SCAMP3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SCAMP3 MS Standard C13 and N15-labeled recombinant protein (NP_005689) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201633 |
| Predicted MW | 38.3 kDa |
| Protein Sequence |
>RC201633 protein sequence
Red=Cloning site Green=Tags(s) MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQ PSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPS FCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFT PCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLML LVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005689 |
| RefSeq Size | 1595 |
| RefSeq ORF | 1041 |
| Synonyms | C1orf3 |
| Locus ID | 10067 |
| Cytogenetics | 1q22 |
| Summary | This gene encodes an integral membrane protein that belongs to the secretory carrier membrane protein family. The encoded protein functions as a carrier to the cell surface in post-golgi recycling pathways. This protein is also involved in protein trafficking in endosomal pathways. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401740 | SCAMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409448 | SCAMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401740 | Transient overexpression lysate of secretory carrier membrane protein 3 (SCAMP3), transcript variant 1 |
CNY 3080.00 |
|
| LY409448 | Transient overexpression lysate of secretory carrier membrane protein 3 (SCAMP3), transcript variant 2 |
CNY 3080.00 |
|
| TP301633 | Recombinant protein of human secretory carrier membrane protein 3 (SCAMP3), transcript variant 1, 20 µg |
CNY 2900.00 |
