S100A4 (NM_019554) Human Mass Spec Standard
CAT#: PH301616
S100A4 MS Standard C13 and N15-labeled recombinant protein (NP_062427)
View other "S100A4" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | S100A4 MS Standard C13 and N15-labeled recombinant protein (NP_062427) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201616 |
| Predicted MW | 11.7 kDa |
| Protein Sequence |
>RC201616 protein sequence
Red=Cloning site Green=Tags(s) MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_062427 |
| RefSeq Size | 564 |
| RefSeq ORF | 303 |
| Synonyms | 18A2; 42A; CAPL; FSP1; MTS1; P9KA; PEL98 |
| Locus ID | 6275 |
| Cytogenetics | 1q21.3 |
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412695 | S100A4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418991 | S100A4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412695 | Transient overexpression lysate of S100 calcium binding protein A4 (S100A4), transcript variant 2 |
CNY 3080.00 |
|
| LY418991 | Transient overexpression lysate of S100 calcium binding protein A4 (S100A4), transcript variant 1 |
CNY 3080.00 |
|
| PH303035 | S100A4 MS Standard C13 and N15-labeled recombinant protein (NP_002952) |
CNY 19520.00 |
|
| TP301616 | Recombinant protein of human S100 calcium binding protein A4 (S100A4), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP303035 | Recombinant protein of human S100 calcium binding protein A4 (S100A4), transcript variant 1, 20 µg |
CNY 2900.00 |
