SNAP23 (NM_003825) Human Mass Spec Standard
CAT#: PH301596
SNAP23 MS Standard C13 and N15-labeled recombinant protein (NP_003816)
View other "SNAP23" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SNAP23 MS Standard C13 and N15-labeled recombinant protein (NP_003816) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201596 |
| Predicted MW | 23.4 kDa |
| Protein Sequence |
>RC201596 protein sequence
Red=Cloning site Green=Tags(s) MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETE KTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYI KRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLID S myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003816 |
| RefSeq Size | 2650 |
| RefSeq ORF | 633 |
| Synonyms | HsT17016; SNAP-23; SNAP23A; SNAP23B |
| Locus ID | 8773 |
| Cytogenetics | 15q15.1-q15.2 |
| Summary | Specificity of vesicular transport is regulated, in part, by the interaction of a vesicle-associated membrane protein termed synaptobrevin/VAMP with a target compartment membrane protein termed syntaxin. These proteins, together with SNAP25 (synaptosome-associated protein of 25 kDa), form a complex which serves as a binding site for the general membrane fusion machinery. Synaptobrevin/VAMP and syntaxin are believed to be involved in vesicular transport in most, if not all cells, while SNAP25 is present almost exclusively in the brain, suggesting that a ubiquitously expressed homolog of SNAP25 exists to facilitate transport vesicle/target membrane fusion in other tissues. The protein encoded by this gene is structurally and functionally similar to SNAP25 and binds tightly to multiple syntaxins and synaptobrevins/VAMPs. It is an essential component of the high affinity receptor for the general membrane fusion machinery and is an important regulator of transport vesicle docking and fusion. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401266 | SNAP23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408951 | SNAP23 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401266 | Transient overexpression lysate of synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1 |
CNY 3080.00 |
|
| LY408951 | Transient overexpression lysate of synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 2 |
CNY 3080.00 |
|
| TP301596 | Recombinant protein of human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP761961 | Purified recombinant protein of Human synaptosomal-associated protein, 23kDa (SNAP23), transcript variant 2,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2050.00 |
