PRP18 homolog (PRPF18) (NM_003675) Human Mass Spec Standard
CAT#: PH301556
PRPF18 MS Standard C13 and N15-labeled recombinant protein (NP_003666)
View other "PRP18 homolog" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | PRPF18 MS Standard C13 and N15-labeled recombinant protein (NP_003666) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201556 |
| Predicted MW | 39.9 kDa |
| Protein Sequence |
>RC201556 protein sequence
Red=Cloning site Green=Tags(s) MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLTSSNPVLELEL AEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLN EIVGGQEPGEEDTQNDLKVHEENTTIEELEALGESLGKGDDHKDMDIITKFLKFLLGVWAKELNAREDYV KRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWP IGVTMVGIHARTGREKIFSKHVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003666 |
| RefSeq Size | 1711 |
| RefSeq ORF | 1026 |
| Synonyms | hPrp18; PRP18 |
| Locus ID | 8559 |
| Cytogenetics | 10p13 |
| Summary | Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to the yeast splicing factor Prp18. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418505 | PRPF18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418505 | Transient overexpression lysate of PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18) |
CNY 3080.00 |
|
| TP301556 | Recombinant protein of human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18), 20 µg |
CNY 2900.00 |
其它PRP18 homolog产品
