Annexin A3 (ANXA3) (NM_005139) Human Mass Spec Standard
CAT#: PH301540
ANXA3 MS Standard C13 and N15-labeled recombinant protein (NP_005130)
View other "Annexin A3" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ANXA3 MS Standard C13 and N15-labeled recombinant protein (NP_005130) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201540 |
| Predicted MW | 36.4 kDa |
| Protein Sequence |
>RC201540 protein sequence
Red=Cloning site Green=Tags(s) MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSNAQRQLIVKEYQAAYGKELKD DLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSL GDDISSETSGDFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLK LTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRS EIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005130 |
| RefSeq Size | 1634 |
| RefSeq ORF | 969 |
| Synonyms | ANX3 |
| Locus ID | 306 |
| Cytogenetics | 4q21.21 |
| Summary | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. [provided by RefSeq, Jul 2008] |
| Protein Families | Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417500 | ANXA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417500 | Transient overexpression lysate of annexin A3 (ANXA3) |
CNY 3080.00 |
|
| TP301540 | Recombinant protein of human annexin A3 (ANXA3), 20 µg |
CNY 2900.00 |
|
| TP721189 | Purified recombinant protein of Human annexin A3 (ANXA3) |
CNY 1800.00 |
其它Annexin A3产品
